DOG-1 / TMEM16A (Clone DOG-1.1)
ARA0363-C.1
$ 199.00
Shipping
$45.00 to United States.
Order now and get your product by
Guarantee
We promise excellent product performance and responsive customer service. Our products come with a 100% money back guarantee.
Species: Mouse
Immunogen: A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLLETCMEKERQKDEPPCNHHNTKACPDSLGSPAPSHAYHGGVL), conjugated to a carrier protein.
Clone: DOG-1.1
Isotype: : IgG1, kappa
Species Reactivity: Human. Others not known.
Positive Control: Gastrointestinal Stromal Tumor (GIST) or testicular germ cell tumor. Melanocytes in the basal layer of the epidermis and mast cells in the dermis of normal skin.
Specificity: DOG1.1 is a sensitive and specific immunohistochemical marker for GIST, comparable with c-Kit, with the additional benefit of detecting c-Kit-negative GISTs. DOG1.1 is also a sensitive marker for unusual GIST subgroups lacking c-Kit or PDGFRA mutations.
Instructions For Use
MSDS
Related Items
ACTH (Clone 57)
$ 199.00
Species: Mouse
Immunogen: N-terminal fragment of human ACTH conjugated to KLH
Clone: 57
Isotype: IgG1, kappa
Species Reactivity: Human and Rat. Expected to show a broad species reactivity.
Positive Control: Normal pituitary gland or pituitary tumor.
Specificity: This antibody is specific to Synacthen (aa 1-24 of ACTH); this antibody does not react with CLIP (aa 17-39 of ACTH). Anti-ACTH is a useful marker in classification of pituitary tumors and in the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH.
View full product details »
ACTH (Clone AH26 & 57)
$ 199.00
Species: Mouse
Immunogen: Synthetic peptide corresponding to aa 1-24 of human ACTH (AH26); N-terminal fragment of human ACTH conjugated to KLH (57).
Clone: AH26 & 57
Isotype: IgG1, kappa (AH26); IgG1, kappa (57).
Species Reactivity: Human, Mouse, and Rat. Expected to show a broad species reactivity.
Positive Control: Normal pituitary gland or pituitary tumor.
Specificity: This antibody is specific to Synacthen (aa 1-24 of ACTH); this antibody does not react with CLIP (aa 17-39 of ACTH). Anti-ACTH is a useful marker in classification of pituitary tumors and in the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH.
Instructions For Use
MSDS
View full product details »
ACTH (Clone AH26)
$ 199.00
Species: Mouse
Immunogen: Synthetic peptide corresponding to aa 1-24 of human ACTH
Clone: AH26
Isotype: IgG1, kappa
Species Reactivity: Human, Mouse and Rat. Expected to show a broad species reactivity.
Positive Control: Normal pituitary gland or pituitary tumor.
Specificity: This antibody is specific to Synacthen (aa 1-24 of ACTH); this antibody does not react with CLIP (aa 17-39 of ACTH). Anti-ACTH is a useful marker in classification of pituitary tumors and in the study of pituitary disease. It reacts with ACTH-producing cells (corticotrophs). It also may react with other tumors (e.g. some small cell carcinomas of the lung) causing paraneoplastic syndromes by secreting ACTH.
Instructions For Use
MSDS
View full product details »